Product name	Anti-ORF7a protein polyclonal antibody
Source	P0DTC7
Species	SARS-CoV-2
Molecular weight	13kDa
Buffer	PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form	Liquid
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term; -20°c or -80°C for long term
Brand	Proteogenix
Host species	Rabbit
Applications	ELISA
Aliases – Synonyms	ORF7a protein
Size	100ug
Reference	PTXCOV-A559
Note	For research use and in vitro diagnostic only. Not suitable for human use.
Isotype	IgG
Clonality	Polyclonal Antibody
Target	ORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Anti-ORF7a protein polyclonal antibody”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

€330.00In stock

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.