Product name	C-type lectin domain family 9 member A(CLEC9A)
Uniprot ID	Q6UXN8
Uniprot link	https://www.uniprot.org/uniprot/Q6UXN8
Expression system	Prokaryotic expression
Sequence	MKYLLPTAAAGLLLLAAQPAMAKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFMQNSLSSAHNSSPCP NNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSP SPGLLPAERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSVGSHHHHHH
Molecular weight	24.35kDa
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH7.5, 4M urea
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Lys57-Val241
Aliases /Synonyms	CD370
Reference	PX-P4353
Note	For research use only

No Products found