Contact Book a call
+33 (0)3 90 20 54 70
Contact Book a call
Contact Book a call
Nycodenz AG® Nycodenz AG® XtenCHO ™ Starter kit XtenCHO ™ Starter kit
View all Products

Human Aggrecan (17-392) Recombinant Protein

Reference:
Size

100ug, 50ug
Brand

Product type

Host Species

Applications

,

Tags:
Specification
Documents
Publications
Reviews
Product nameHuman Aggrecan (17-392) Recombinant Protein
Uniprot IDQ6PID9
Uniprot linkhttp://www.uniprot.org/uniprot/Q6PID9
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLDDDDKAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPVTTAPSTAPLAPRIKWSRVSK EKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEVQSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAI STRYTLDFDRAQRACLQNSAIIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAGWLADRSVRYPISKARPNCGG NLLGVRTVYVHANQTGYPDPSSRYDAICYTGEDFVDIPENFFGVGGEEDITVQTVTWPDMELPLPRNITEGE
Molecular weight43,73 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, imidazole 400mM, Urea 6M, pH8 in denaturing conditions. In native conditions : PBS, DTT 1mM, pH7.4
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionAAH36445.1
Spec:SwissProtIDQ6PID9
NCBI ReferenceAAH36445.1
Aliases /SynonymsAggrecan [17-392], Aggrecan, ACAN, Aggrecan core protein
ReferencePX-P1069
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Casa NL, Casa Junior AJ, Melo AV, Teodoro LS, Nascimento GR, Sousa AF, Flausino TC, Brito D, Bergamini R, Minasi LB, da Cruz AD, Vieira TC, Curado MP. CASE-REPORT Association between an ACAN gene variable number tandem repeat polymorphism and lumbar disc herniation: a case control study. Genet Mol Res. 2016 Dec 19;15(4). doi: 10.4238/gmr15048867. PubMed PMID: 28002585.
  • 2: Glant TT, Ocsko T, Markovics A, Szekanecz Z, Katz RS, Rauch TA, Mikecz K. Characterization and Localization of Citrullinated Proteoglycan Aggrecan in Human Articular Cartilage. PLoS One. 2016 Mar 4;11(3):e0150784. doi: 10.1371/journal.pone.0150784. eCollection 2016. PubMed PMID: 26943656; PubMed Central PMCID: PMC4778950.
  • 3: Ristolainen H, Kilpivaara O, Kamper P, Taskinen M, Saarinen S, Leppä S, d'Amore F, Aaltonen LA. Identification of homozygous deletion in ACAN and other candidate variants in familial classical Hodgkin lymphoma by exome sequencing. Br J Haematol. 2015 Aug;170(3):428-31. doi: 10.1111/bjh.13295. Epub 2015 Feb 25. PubMed PMID: 25715982.
  • 4: Pantazopoulos H, Markota M, Jaquet F, Ghosh D, Wallin A, Santos A, Caterson B, Berretta S. Aggrecan and chondroitin-6-sulfate abnormalities in schizophrenia and bipolar disorder: a postmortem study on the amygdala. Transl Psychiatry. 2015 Jan 20;5:e496. doi: 10.1038/tp.2014.128. PubMed PMID: 25603412; PubMed Central PMCID: PMC4312825.
  • 5: Cong L, Zhu Y, Pang H, Guanjun TU. The interaction between aggrecan gene VNTR polymorphism and obesity in predicting incident symptomatic lumbar disc herniation. Connect Tissue Res. 2014 Oct-Dec;55(5-6):384-90. doi: 10.3109/03008207.2014.959117. Epub 2014 Sep 22. PubMed PMID: 25188217.
  • 6: Gu J, Guan F, Guan G, Xu G, Wang X, Zhao W, Ji Y, Yan J. Aggrecan variable number of tandem repeat polymorphism and lumbar disc degeneration: a meta-analysis. Spine (Phila Pa 1976). 2013 Dec 1;38(25):E1600-7. doi: 10.1097/BRS.0000000000000012. PubMed PMID: 24296484.
  • 7: Hu G, Codina M, Fisher S. Multiple enhancers associated with ACAN suggest highly redundant transcriptional regulation in cartilage. Matrix Biol. 2012 Jul;31(6):328-37. doi: 10.1016/j.matbio.2012.06.001. Epub 2012 Jul 20. PubMed PMID: 22820679; PubMed Central PMCID: PMC3508301.
  • 8: Eser O, Eser B, Cosar M, Erdogan MO, Aslan A, Yıldız H, Solak M, Haktanır A. Short aggrecan gene repetitive alleles associated with lumbar degenerative disc disease in Turkish patients. Genet Mol Res. 2011 Aug 30;10(3):1923-30. doi: 10.4238/vol10-3gmr1222. PubMed PMID: 21948754.
  • 9: Gruber HE, Hoelscher GL, Ingram JA, Bethea S, Zinchenko N, Hanley EN Jr. Variations in aggrecan localization and gene expression patterns characterize increasing stages of human intervertebral disk degeneration. Exp Mol Pathol. 2011 Oct;91(2):534-9. doi: 10.1016/j.yexmp.2011.06.001. Epub 2011 Jun 12. PubMed PMID: 21689646.
  • 10: Stacey MW, Neumann SA, Dooley A, Segna K, Kelly RE, Nuss D, Kuhn AM, Goretsky MJ, Fecteau AH, Pastor A, Proud VK. Variable number of tandem repeat polymorphisms (VNTRs) in the ACAN gene associated with pectus excavatum. Clin Genet. 2010 Nov;78(5):502-4. doi: 10.1111/j.1399-0004.2010.01492.x. PubMed PMID: 21039430.
  • 11: Kim NK, Shin DA, Han IB, Yoo EH, Kim SH, Chung SS. The association of aggrecan gene polymorphism with the risk of intervertebral disc degeneration. Acta Neurochir (Wien). 2011 Jan;153(1):129-33. doi: 10.1007/s00701-010-0831-2. Epub 2010 Oct 10. PubMed PMID: 20936487.
  • 12: Jowitt TA, Murdoch AD, Baldock C, Berry R, Day JM, Hardingham TE. Order within disorder: aggrecan chondroitin sulphate-attachment region provides new structural insights into protein sequences classified as disordered. Proteins. 2010 Dec;78(16):3317-27. doi: 10.1002/prot.22839. PubMed PMID: 20806220; PubMed Central PMCID: PMC3546398.
  • 13: Cong L, Pang H, Xuan D, Tu GJ. Association between the expression of aggrecan and the distribution of aggrecan gene variable number of tandem repeats with symptomatic lumbar disc herniation in Chinese Han of Northern China. Spine (Phila Pa 1976). 2010 Jun 15;35(14):1371-6. doi: 10.1097/BRS.0b013e3181c4e022. PubMed PMID: 20505571.
  • 14: Mashayekhi F, Shafiee G, Kazemi M, Dolati P. Lumbar disk degeneration disease and aggrecan gene polymorphism in northern Iran. Biochem Genet. 2010 Aug;48(7-8):684-9. doi: 10.1007/s10528-010-9350-3. Epub 2010 May 23. PubMed PMID: 20496110.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human Aggrecan (17-392) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products