Product name	Human FGF10 Recombinant Protein
Uniprot ID	O15520
Uniprot link	http://www.uniprot.org/uniprot/O15520
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MAQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHSLEHHHHHH
Molecular weight	20.59 kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	PBS,pH 7.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
NCBI Reference	O15520
Aliases /Synonyms	Keratinocyte Growth Factor proteins 2,Fibroblast Growth Factor proteins 10, FGF10
Reference	PX-P3026
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human FGF10 Recombinant Protein”

Size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.