Contact Book a call
+33 (0)3 90 20 54 70
Contact Book a call
Contact Book a call
Nycodenz AG® Nycodenz AG® XtenCHO ™ Starter kit XtenCHO ™ Starter kit
View all Products

Human FGF2b Recombinant Protein

Reference:
Size

100ug, 50ug
Brand

Product type

Host Species

Applications

,

Tags:
Specification
Documents
Publications
Reviews
Product nameHuman FGF2b Recombinant Protein
Uniprot IDP09038
Uniprot linkhttp://www.uniprot.org/uniprot/P09038
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMAHNHRHKHKLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVC ANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Molecular weight17,76 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypePartial
Protein AccessionAAA52534.1
Spec:Entrez GeneID2247
Spec:NCBI Gene AliasesFGFB, HBGF-2, FGF-2, BFGF
Spec:SwissProtIDP09038
NCBI ReferenceAAA52534.1
Aliases /SynonymsFGF2b, basic fibroblast Growth Factor proteins, FGF2, Fibroblast Growth Factor proteins 2, FGF-2, bFGF, Heparin-binding Growth Factor proteins 2, HBGF-2
ReferencePX-P1089
NoteFor research use only
Datasheet Download
MSDS Download

Publication

  • 1: Wróbel T, Butrym A, Łacina P, Rybka J, Gębura K, Mazur G, Bogunia-Kubik K. bFGF Polymorphism Is Associated with Disease Progression and Response to Chemotherapy in Multiple Myeloma Patients. Anticancer Res. 2017 Apr;37(4):1799-1803. PubMed PMID: 28373444.
  • 2: Neutralizing Monoclonal Antibody 3B1 Against Human Basic Fibroblast Growth Factor. Monoclon Antib Immunodiagn Immunother. 2016 Apr;35(2):122. doi: 10.1089/mab.2015.0080. PubMed PMID: 27097071.
  • 3: Hao RH, Guo Y, Dong SS, Weng GZ, Yan H, Zhu DL, Chen XF, Chen JB, Yang TL. Associations of Plasma FGF2 Levels and Polymorphisms in the FGF2 Gene with Obesity Phenotypes in Han Chinese Population. Sci Rep. 2016 Feb 16;6:19868. doi: 10.1038/srep19868. PubMed PMID: 26879180; PubMed Central PMCID: PMC4754629.
  • 4: Shi H, Xu J, Zhao R, Wu H, Gu L, Chen Y. FGF2 regulates proliferation, migration, and invasion of ECA109 cells through PI3K/Akt signalling pathway in vitro. Cell Biol Int. 2016 May;40(5):524-33. doi: 10.1002/cbin.10588. Epub 2016 Mar 9. PubMed PMID: 26833879.
  • 5: Hu M, Hu Y, He J, Li B. Prognostic Value of Basic Fibroblast Growth Factor proteins (bFGF) in Lung Cancer: A Systematic Review with Meta-Analysis. PLoS One. 2016 Jan 29;11(1):e0147374. doi: 10.1371/journal.pone.0147374. eCollection 2016. Review. PubMed PMID: 26824699; PubMed Central PMCID: PMC4732945.
  • 6: Ye L, Yang Y, Zhang X, Cai P, Li R, Chen D, Wei X, Zhang X, Xu H, Xiao J, Li X, Lin L, Zhang H. The Role of bFGF in the Excessive Activation of Astrocytes Is Related to the Inhibition of TLR4/NFκB Signals. Int J Mol Sci. 2015 Dec 28;17(1). pii: E37. doi: 10.3390/ijms17010037. PubMed PMID: 26729092; PubMed Central PMCID: PMC4730282.
  • 7: Twaroski K, Mallanna SK, Jing R, DiFurio F, Urick A, Duncan SA. FGF2 mediates hepatic progenitor cell formation during human pluripotent stem cell differentiation by inducing the WNT antagonist NKD1. Genes Dev. 2015 Dec 1;29(23):2463-74. doi: 10.1101/gad.268961.115. PubMed PMID: 26637527; PubMed Central PMCID: PMC4691950.
  • 8: Lim S, Cho H, Lee E, Won Y, Kim C, Ahn W, Lee E, Son Y. Osteogenic stimulation of human adipose-derived stem cells by pre-treatment with fibroblast growth factor 2. Cell Tissue Res. 2016 Apr;364(1):137-47. doi: 10.1007/s00441-015-2311-8. Epub 2015 Nov 7. PubMed PMID: 26547859.
  • 9: Chen Y, Zhu G, Wu K, Gao Y, Zeng J, Shi Q, Guo P, Wang X, Chang LS, Li L, He D. FGF2-mediated reciprocal tumor cell-endothelial cell interplay contributes to the growth of chemoresistant cells: a potential mechanism for superficial bladder cancer recurrence. Tumour Biol. 2016 Apr;37(4):4313-21. doi: 10.1007/s13277-015-4214-4. Epub 2015 Oct 22. PubMed PMID: 26493998.
  • 10: Zhao W, Yu H, Han Z, Gao N, Xue J, Wang Y. Clinical significance of joint detection of serum CEA, SCCA, and bFGF in the diagnosis of lung cancer. Int J Clin Exp Pathol. 2015 Aug 1;8(8):9506-11. eCollection 2015. PubMed PMID: 26464712; PubMed Central PMCID: PMC4583944.
  • 11: Litwin M, Radwańska A, Paprocka M, Kieda C, Dobosz T, Witkiewicz W, Baczyńska D. The role of FGF2 in migration and tubulogenesis of endothelial progenitor cells in relation to pro-angiogenic Growth Factor proteins production. Mol Cell Biochem. 2015 Dec;410(1-2):131-42. doi: 10.1007/s11010-015-2545-5. Epub 2015 Aug 28. PubMed PMID: 26314253.
  • 12: Fessler E, Borovski T, Medema JP. Endothelial cells induce cancer stem cell features in differentiated glioblastoma cells via bFGF. Mol Cancer. 2015 Aug 19;14:157. doi: 10.1186/s12943-015-0420-3. PubMed PMID: 26282129; PubMed Central PMCID: PMC4539660.
  • 13: Jerebtsova M, Das JR, Tang P, Wong E, Ray PE. Angiopoietin-1 prevents severe bleeding complications induced by heparin-like drugs and fibroblast growth factor-2 in mice. Am J Physiol Heart Circ Physiol. 2015 Oct;309(8):H1314-25. doi: 10.1152/ajpheart.00373.2015. Epub 2015 Aug 14. PubMed PMID: 26276817; PubMed Central PMCID: PMC4666966.
  • 14: Hurley MM, Adams DJ, Wang L, Jiang X, Burt PM, Du E, Xiao L. Accelerated fracture healing in transgenic mice overexpressing an anabolic isoform of fibroblast Growth Factor proteins 2. J Cell Biochem. 2016 Mar;117(3):599-611. doi: 10.1002/jcb.25308. PubMed PMID: 26252425.
  • 15: Li S, Payne S, Wang F, Claus P, Su Z, Groth J, Geradts J, de Ridder G, Alvarez R, Marcom PK, Pizzo SV, Bachelder RE. Nuclear basic fibroblast growth factor regulates triple-negative breast cancer chemo-resistance. Breast Cancer Res. 2015 Jul 4;17:91. doi: 10.1186/s13058-015-0590-3. PubMed PMID: 26141457; PubMed Central PMCID: PMC4491247.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human FGF2b Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade
Biosimilar

Burosumab Biosimilar – Anti-FGF23 mAb – Research Grade

PX-TA1437 400€
View product

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products