Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Product name	Lipase Protein- Propionibacterium Acnes LIPASE Recombinant Protein
Uniprot ID	Q6A601
Uniprot link	http://www.uniprot.org/uniprot/Q6A601
Origin species	Propionibacterium acnes
Expression system	Prokaryotic expression
Sequence	MAHNHRHKHKLATSPGDIHPLVQAAHSPDGIPGNGVGPEFHTSSMARSYSEKHLGVAPRGVNDFSCKVKPGDRPVILIPG TGGNAFATWSFYGPHLAHEGYCVYTFTTNVPVGILDEGWGFTGDVRASAQALGAFVDRVRKATGSEKVDFVGHSQGGGIL PNAYIKMYGGASKVDKLIGLVAANHGTTAVGLDKLVDGLPEAVKDFLSTWSYDHNMEAYGQQLKGSALMQQVYRDGDTVP GIAYTVISTRLDMTVTPYTQAFLKGAKNMTVQDACPLDAYGHGRLPYDPVAYQMVLNALDPNHPREISCTWRPRVLPVST TDAA
Molecular weight	34,73 kDa
Protein delivered with Tag?	Yes
Purity estimated	>95%
Buffer	PBS pH7.5, DTT 1mM, 0.5mM Zwittergent 3-14 and 10% Glycerol if refolding. PBS, Urea 8M if denaturing conditions
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	Lipase protein is stored: At 4°C for short term period (less than a week) At -20°C or -80°C for long term period Recommendations It is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Partial
Protein Accession	YP_056770.1
Spec:Entrez GeneID	2932970
Spec:SwissProtID	Q6A601
NCBI Reference	YP_056770.1
Aliases /Synonyms	LIPASE, triacylglycerol lipase precursor
Reference	PX-P1121
Note	For research use only

Description of Lipase Protein/ Propionibacterium Acnes LIPASE Recombinant Protein

General information on Lipase Protein:

Propionibacterium acnes lipase is a protein secreted by the Propionibacterium acnes which is a gram-positive anaerobic bacterium. This lipase protein metabolizes sebum which in turn results into metabolites that are responsible for the human skin condition known as acne vulgaris. It is also believed that lipase overexpression increases follicular development.
Propionibacterium acnes lipase protein acts on triglycerides to release free fatty acids. Among the fatty acids released, Palmitic acid stimulates the toll-like receptor 2-mediated inflammasome. The latter is associated with the release of interleukin-1, Th17 differenciation and interleukin-17-mediated keratinocyte proliferation. Oleic acid, another fatty acid released stimulates adhesion and keratinocyte proliferation in Propionibacterium acnes, also via the release of interleukin-1.
Antifugal drug ketoconazole has been suggested to inhibit P.acnes lipase activity. However, the mechanism by which ketoconazole inhibits P.acnes lipase protein remains unknown.

Datasheet Download

MSDS Download

Reviews

There are no reviews yet.