Macrophage migration inhibitory factor(MIF)

Reference: PX-P4589-100
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameMIF Protein - Macrophage migration inhibitory factor(MIF)
Uniprot IDP14174
Uniprot linkhttps://www.uniprot.org/uniprot/P14174
Expression systemProkaryotic expression
SequenceMPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALC SLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Molecular weight13.41kDa
Purity estimated>80% by SDS-PAGE
Buffer50 mM Tris-HCl, pH 7.5, 150 mM NaCl
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
ApplicationsELISA,WB
Fragment TypeMet1-Ala115
Aliases /SynonymsGLIF, MMIF,Glycosylation-inhibiting factor、GIF、L-dopachrome isomerase、L-dopachrome tautomerase 、Phenylpyruvate tautomerase
ReferencePX-P4589
NoteFor research use only

Description of MIF Protein / Macrophage migration inhibitory factor(MIF)

General information on MIF protein

MIF protein also known as macrophage migration inhibitory factor, glycosylation-inhibiting factor (GIF), phenylpyruvate or L-dopachrome is a protein encoded by MIF gene in humans. The protein is part of tautomerase superfamily of proteins. The proteins belonging to this superfamily are characterized by the utilization of N-terminal protein in their mechanism. Unlike many of the proteins part of this superfamily, MIF protein is not involved in cytokine activity. The protein is believed to mediate and regulate the function of macrophages in host defense and counteracts the anti-inflammatory activity of molecules such as glucocorticoids.
nnMIF protein is released upon stimulation of white blood cells by bacterial antigens. The MIF protein then binds to CD74 protein. The latter is a transmembrane molecule expressed by B-cells, mantle cells and particularly follicular center cells. The CD74-MIF protein complex triggers an acute immune response. Glucocorticoids also stimulate MIF protein release by acting on white blood cells. MIF protein may also be released following the activation of the anterior pituary gland as a result trauma.
nnMIF protein assembles into a trimer that consists of three identical subunits. Each monomer contain a four-stranded beta sheet and two antiparallel alpha helices. The monomers are located around a central channel with 3-fold rational symmetry.
nnMIF proteins contains two motifs responsible for its catalytic activity. One of the motifs has 27 amino acids and is located at the N-terminus of the protein chain. It functions as a phenylpyruvate tautomerase and catalyzes the conversion of 2-carboxy-2,3-dihydroindole-5,6-quinone (also known as dopachrome) into 5,6-dihydroxyindole-2-carboxylic acid (also known as DHICA). The other catalytic site is located between residues 57 and 60 and appears to act as a disulfide reductase. MIF protein has been reported to interact with a range of proteins such as BNIPL, CD74, COPS5, CXCR4 and RPS19. MIF protein has been considered as a potential drug target for cancer, sepsis and rheumatoid arthritis.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Macrophage migration inhibitory factor(MIF)”

Your email address will not be published. Required fields are marked *

Related products

Imalumab Biosimilar – Anti-MIF mAb – Research Grade
Biosimilar

Imalumab Biosimilar – Anti-MIF mAb – Research Grade

PX-TA1359 400€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products