size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Mammalian cells
Applications	Elisa, WB

Product name	PfEMP1 variant 1 of strain MC ( MCvar-1 PfEMP1)
Uniprot ID	Q25733
Uniprot link	https://www.uniprot.org/uniprot/Q25733
Expression system	Eukaryotic expression
Sequence	MGILPSPGMPALLSLVSLLSVLLMGCVAETGEDKIMSYNAFFWMWVHDMLIDSIKWRDEHGRCINKDKGKTCIKGCNKKCISFQKWVEQKKTEWGKIKDHFRKQKDIPKDWTHDDFLQTLLMKDLLLEIIQDTYGDANEIKRIEALLEQAGVGGIDFAALAGLYTKGFVAEKDTTIDKLLQHEQKEADKCLKTHTDDTCPPGTHHHHHHHH
Molecular weight	24.2kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS, pH7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Glu576-Pro745
Protein Accession	Q25733
Spec:SwissProtID	Q25733
NCBI Reference	Q25733
Reference	PX-P4676
Note	For research use only

No Products found