Product name	Protein A, von Willebrand factor binding protein Spa(spa)
Uniprot ID	A0A098GZT2 or P38507
Uniprot link	http://www.uniprot.org/uniprot/A0A098GZT2
Expression system	Prokaryotic expression
Sequence	MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEEQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Molecular weight	38.33kDa
Purity estimated	>90% by SDS-PAGE
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Met1~Lys327
Aliases /Synonyms	Immunoglobulin G-binding protein A, IgG-binding protein A, Staphylococcal protein A
Reference	PX-P4556
Note	For research use only

No Products found