Product name	Secretory Leukocyte Peptidase Inhibitor (SLPI)
Uniprot ID	P97430
Uniprot link	https://www.uniprot.org/uniprot/P97430
Expression system	Prokaryotic expression
Sequence	PWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
Molecular weight	12.37 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>68% % by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL, 5% Trehalose
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Pro20~Met131
Protein Accession	P97430
Spec:Entrez GeneID	20568
Spec:NCBI Gene Aliases	ALP
Spec:SwissProtID	O09081
NCBI Reference	P97430
Aliases /Synonyms	ALK1; ALP; MPI; BLPI; HUSI; HUSI-I; WAP4; WFDC4
Reference	PX-P4591
Note	For research use only

No Products found