Product name	Trypsinogen
Uniprot ID	C5IWV5
Uniprot link	https://www.uniprot.org/uniprot/C5IWV5
Expression system	Eukaryotic expression
Sequence	DEDDDKIVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAANHHHHHH
Molecular weight	25kDa
Protein delivered with Tag?	C-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS, pH 6.0
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Yeast
Applications	ELISA,WB
Fragment Type	Asp20-Asn246
Protein Accession	XP_020934123
Spec:Entrez GeneID	100302368
NCBI Reference	XP_020934123
Aliases /Synonyms	/
Reference	PX-P4831
Note	For research use only

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Trypsinogen”

size

Clear

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

PTX17851 180€

View product

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.