VSVG Protein- Drosophila VSVG NJ Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

Product type

Host Species

Applications

,

Product nameVSVG Protein- Drosophila VSVG NJ Recombinant Protein
Uniprot IDP15425
Uniprot linkhttp://www.uniprot.org/uniprot/P15425
Origin speciesDrosophila
Expression systemEukaryotic expression
SequenceMLSYLILAIVVSPILGKIEIVFPQHTTGDWKRVPHEYNYCPTSADKNSHGTQTGIPVELTMPKGLTTHQVDGFMCHSALW MTTCDFRWYGPKYITHSIHNEEPTDYQCLEAIKAYKDGVSFNPGFPPQSCGYGTVTDAEAHIITVTPHSVKVDEYTGEWI DPHFIGGRCKGKICETVHNSTKWFTSSDGESVCSQLFTIVGGTFFSDSEEITSMGLPETGIRSNYFPYISTEGICKMPFC RKPGYKLKNDLWFQITDPDLDKKVRDLPHIKDCDLSSSIITPGEHATDISLISDVERILDYALCQSTWSKIEAGEPVTPV DLSYLGPKNPGVGPVFTIINGSLHYFTSKYLRVELESPVIPRMEGKVAGTRIVRQLWDQWFPFGEAEIGPNGVLKTKQGY KFPLHIIGTGEVDSDIKMERTVKHWEHPHIEAAQTYLKKDDTEEVIYYGDTGVSKNPVELVEGWFSGWRSSIMGVVAVIF GFVILILLIRLIGVLSSLFRPKKRPIYKSDVEMAHFRGGHNHRHKH
Molecular weight59.11kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferPBS, pH 7.5
FormFrozen
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesInsect
ApplicationsELISA,WB
Fragment TypeFull-length
Protein AccessionNP_476656.1
Spec:Entrez GeneID33271
Spec:NCBI Gene AliasesCG3966, NINAA, DmelCG3966, ninA, NinaA
Spec:SwissProtIDP15425
NCBI ReferenceNP_476656.1
Aliases /SynonymsVSVG, neither inactivation nor afterpotential A, Peptidyl-prolyl cis-trans isomerase, rhodopsin-specific isozyme, PPIase, Rotamase
ReferencePX-P2099
NoteFor research use only

Description of VSVG Protein/ Drosophila VSVG NJ Recombinant Protein

General Information on VSVG NJ Protein:

Vesicular stomatitis virus (VSV) glycoproteins mediate both cell attachment and membrane fusion. Unlike many other low-pH-induced viral fusion proteins, their fusogenic conformational transitions is reversible. VSV-G has a three-stage fusion kinetics:
I. G-protein conformational change which is reversible and pH-dependent.
II. Reversible trimerization and clustering of the G-protein fusion loops.
III. Folding back of a cluster of extended trimers into their post-fusion conformations.
VSV NJ glycoprotein contains 517 amino acids and is glycosylated at position 178 and 335. Unlike VSV Indiana (VSIV), another major serotype of VSV, VSV NJ is not acylated. The two serotypes also differentiate in terms of antigenic structure. VSV NJ has a faster glycoprotein folding intracellularly and with less dependence on glycosylation.

Publication

  • 1: Lenhard T, Reiländer H. Engineering the folding pathway of insect cells: generation of a stably transformed insect cell line showing improved folding of a recombinant membrane protein. Biochem Biophys Res Commun. 1997 Sep 29;238(3):823-30. PubMed PMID: 9325175.
  • 2: Hemenway C, Heitman J. Proline isomerases in microorganisms and small eukaryotes. Ann N Y Acad Sci. 1993 Nov 30;696:38-46. Review. PubMed PMID: 8109845.
  • 3: Larrivee DC, Conrad SK, Stephenson RS, Pak WL. Mutation that selectively affects rhodopsin concentration in the peripheral photoreceptors of Drosophila melanogaster. J Gen Physiol. 1981 Nov;78(5):521-45. PubMed PMID: 6796648; PubMed Central PMCID: PMC2228638.
  • 4: Pak WL, Conrad SK, Kremer NE, Larrivee DC, Schinz RH, Wong F. Photoreceptor function. Basic Life Sci. 1980;16:331-46. PubMed PMID: 6779798.
  • 5: Schneuwly S, Shortridge RD, Larrivee DC, Ono T, Ozaki M, Pak WL. Drosophila ninaA gene encodes an eye-specific cyclophilin (cyclosporine A binding protein). Proc Natl Acad Sci U S A. 1989 Jul;86(14):5390-4. PubMed PMID: 2664782; PubMed Central PMCID: PMC297628.
  • 6: Shieh BH, Stamnes MA, Seavello S, Harris GL, Zuker CS. The ninaA gene required for visual transduction in Drosophila encodes a homologue of cyclosporin A-binding protein. Nature. 1989 Mar 2;338(6210):67-70. PubMed PMID: 2493138.
  • 7: Webel R, Menon I, O'Tousa JE, Colley NJ. Role of asparagine-linked oligosaccharides in rhodopsin maturation and association with its molecular chaperone, NinaA. J Biol Chem. 2000 Aug 11;275(32):24752-9. PubMed PMID: 10811808.
  • 8: Kurada P, Tonini TD, Serikaku MA, Piccini JP, O'Tousa JE. Rhodopsin maturation antagonized by dominant rhodopsin mutants. Vis Neurosci. 1998 Jul-Aug;15(4):693-700. PubMed PMID: 9682871.
  • 9: Bentrop J, Schwab K, Pak WL, Paulsen R. Site-directed mutagenesis of highly conserved amino acids in the first cytoplasmic loop of Drosophila Rh1 opsin blocks rhodopsin synthesis in the nascent state. EMBO J. 1997 Apr 1;16(7):1600-9. PubMed PMID: 9130705; PubMed Central PMCID: PMC1169764.
  • 10: Ondek B, Hardy RW, Baker EK, Stamnes MA, Shieh BH, Zuker CS. Genetic dissection of cyclophilin function. Saturation mutagenesis of the Drosophila cyclophilin homolog ninaA. J Biol Chem. 1992 Aug 15;267(23):16460-6. PubMed PMID: 1644830.
  • 11: Zuker CS, Mismer D, Hardy R, Rubin GM. Ectopic expression of a minor Drosophila opsin in the major photoreceptor cell class: distinguishing the role of primary receptor and cellular context. Cell. 1988 May 6;53(3):475-82. PubMed PMID: 2966681.
  • 12: Fouillet A, Levet C, Virgone A, Robin M, Dourlen P, Rieusset J, Belaidi E, Ovize M, Touret M, Nataf S, Mollereau B. ER stress inhibits neuronal death by promoting autophagy. Autophagy. 2012 Jun;8(6):915-26. doi: 10.4161/auto.19716. Epub 2012 Jun 1. PubMed PMID: 22660271; PubMed Central PMCID: PMC3427257.
  • 13: Mitra A, Chinchore Y, Kinser R, Dolph PJ. Characterization of two dominant alleles of the major rhodopsin-encoding gene ninaE in Drosophila. Mol Vis. 2011;17:3224-33. Epub 2011 Dec 14. PubMed PMID: 22194648; PubMed Central PMCID: PMC3244490.
  • 14: Ahmad ST, Natochin M, Barren B, Artemyev NO, O'Tousa JE. Heterologous expression of bovine rhodopsin in Drosophila photoreceptor cells. Invest Ophthalmol Vis Sci. 2006 Sep;47(9):3722-8. PubMed PMID: 16936079.
  • 15: Ozaki K, Nagatani H, Ozaki M, Tokunaga F. Maturation of major Drosophila rhodopsin, ninaE, requires chromophore 3-hydroxyretinal. Neuron. 1993 Jun;10(6):1113-9. PubMed PMID: 8318232.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “VSVG Protein- Drosophila VSVG NJ Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Camidanlumab Biosimilar – Anti-IL2RA, CD25 mAb – Research Grade
Biosimilar

Camidanlumab Biosimilar – Anti-IL2RA, CD25 mAb – Research Grade

PX-TA1163 400€
Fulranumab Biosimilar – Anti-NGF, NGFB mAb – Research Grade
Biosimilar

Fulranumab Biosimilar – Anti-NGF, NGFB mAb – Research Grade

PX-TA1256 400€
Anetumab Biosimilar – Anti-MSLN mAb – Research Grade
Biosimilar

Anetumab Biosimilar – Anti-MSLN mAb – Research Grade

PX-TA1330 400€
Enfortumab Biosimilar – Anti-PVRL4 mAb – Research Grade
Biosimilar

Enfortumab Biosimilar – Anti-PVRL4 mAb – Research Grade

PX-TA1333 400€
Lifastuzumab Biosimilar – Anti-SLC34A2 mAb – Research Grade
Biosimilar

Lifastuzumab Biosimilar – Anti-SLC34A2 mAb – Research Grade

PX-TA1334 400€
Sofituzumab Biosimilar – Anti-MUC16, CA125 mAb – Research Grade
Biosimilar

Sofituzumab Biosimilar – Anti-MUC16, CA125 mAb – Research Grade

PX-TA1338 400€
Denintuzumab Biosimilar – Anti-CD19 mAb – Research Grade
Biosimilar

Denintuzumab Biosimilar – Anti-CD19 mAb – Research Grade

PX-TA1348 400€
Duvortuxizumab Biosimilar – Anti-CD19, CD3E mAb – Research Grade
Biosimilar

Duvortuxizumab Biosimilar – Anti-CD19, CD3E mAb – Research Grade

PX-TA1432 400€
Talacotuzumab Biosimilar – Anti-NOTCH2,  NOTCH3 mAb – Research Grade
Biosimilar

Talacotuzumab Biosimilar – Anti-NOTCH2, NOTCH3 mAb – Research Grade

PX-TA1476 400€
Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
Biosimilar

Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade

PX-TA1513 400€
Onvatilimab Biosimilar – Anti-VSIR mAb – Research Grade
Biosimilar

Onvatilimab Biosimilar – Anti-VSIR mAb – Research Grade

PX-TA1514 400€
Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade
Biosimilar

Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

PX-TA1515 400€
Teclistamab  Biosimilar – Anti-BCMA-CD3 mAb – Research Grade
Biosimilar

Teclistamab Biosimilar – Anti-BCMA-CD3 mAb – Research Grade

PX-TA1550 400€
Amivantamab  Biosimilar – Anti-EGFR, ME, RCCP2 mAb – Research Grade
Biosimilar

Amivantamab Biosimilar – Anti-EGFR, ME, RCCP2 mAb – Research Grade

PX-TA1576 400€

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.






    Cart (0 Items)

    Your cart is currently empty.

    View Products