Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human GPT2, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8TD30
Molecular weight:
41.35 kDa

Original price was: €220.00.Current price is: €193.00.

50ug 12% OFF + 193 loyalty points
Val174–Ala523
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human GPT2, N-His

Product name ARO-P13226-100
Uniprot ID Q8TD30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Molecular weight 41.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Ala523
Aliases /Synonyms Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, AAT2, ALT2, Glutamate pyruvate transaminase 2, GPT 2, Glutamic--alanine transaminase 2, GPT2
Reference ARO-P13226
Note For research use only.
Molecular Constructor
Val174–Ala523
Product name ARO-P13226-1MG
Uniprot ID Q8TD30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Molecular weight 41.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Ala523
Aliases /Synonyms Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, AAT2, ALT2, Glutamate pyruvate transaminase 2, GPT 2, Glutamic--alanine transaminase 2, GPT2
Reference ARO-P13226
Note For research use only.
Molecular Constructor
Val174–Ala523
Product name ARO-P13226-50
Uniprot ID Q8TD30
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Molecular weight 41.35 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Ala523
Aliases /Synonyms Alanine aminotransferase 2, Glutamic--pyruvic transaminase 2, AAT2, ALT2, Glutamate pyruvate transaminase 2, GPT 2, Glutamic--alanine transaminase 2, GPT2
Reference ARO-P13226
Note For research use only.
Molecular Constructor
Val174–Ala523

Introduction to Recombinant Human GPT2

Recombinant Human GPT2, also known as Glutamate Pyruvate Transaminase 2, is a protein that plays a crucial role in the metabolism of amino acids. It is a recombinant protein, meaning it is produced through genetic engineering techniques, specifically through the use of recombinant DNA technology.

Structure of Recombinant Human GPT2

Recombinant Human GPT2 is a homodimer protein, meaning it is composed of two identical subunits. Each subunit consists of 496 amino acids and has a molecular weight of approximately 55 kDa. The protein has a conserved pyridoxal phosphate (PLP) binding site, which is essential for its enzymatic activity.

The crystal structure of Recombinant Human GPT2 has been determined, revealing a three-dimensional structure that resembles a heart-shaped dimer. The dimerization of the protein is crucial for its stability and enzymatic activity.

Enzymatic Activity of Recombinant Human GPT2

Recombinant Human GPT2 is a transaminase enzyme that catalyzes the reversible conversion of L-glutamate and pyruvate to 2-oxoglutarate and alanine. This reaction plays a crucial role in the metabolism of amino acids, specifically in the interconversion of amino acids between different metabolic pathways.

The enzymatic activity of Recombinant Human GPT2 is dependent on the presence of PLP, which acts as a cofactor for the enzyme. PLP is essential for the formation of a Schiff base intermediate, which is a key step in the transamination reaction.

Applications of Recombinant Human GPT2

Recombinant Human GPT2 has various applications in the fields of biochemistry and biotechnology. One of its primary uses is in the production of recombinant proteins. As a transaminase enzyme, Recombinant Human GPT2 can be used to catalyze the transamination of amino acids, which is a crucial step in the production of recombinant proteins.

Moreover, Recombinant Human GPT2 has been studied for its potential role in the treatment of certain diseases. It has been found that the overexpression of GPT2 can lead to increased levels of alanine, which has been linked to the inhibition of tumor growth. This suggests that Recombinant Human GPT2 may have potential as a therapeutic target for certain types of cancer.

Another potential application of Recombinant Human GPT2 is in the production of diagnostic kits for liver diseases. GPT2 is predominantly found in the liver, and its levels can be used as a biomarker for liver damage. Recombinant Human GPT2 can be used to develop diagnostic tests that can accurately detect liver damage and monitor the progression of liver diseases.

Conclusion

In conclusion, Recombinant Human GPT2 is a homodimer protein that plays a crucial role in the metabolism of amino acids. Its structure, enzymatic activity, and potential applications make it a valuable tool in the fields of biochemistry and biotechnology. Further research on Recombinant Human GPT2 may uncover new insights into its functions and potential therapeutic uses.

Recombinant Human GPT2, N-His

There are no reviews yet.

Be the first to review “Recombinant Human GPT2, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products