Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD81 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P60033
Molecular weight:
22.11 kDa

Original price was: €232.00.Current price is: €193.00.

50ug 17% OFF + 193 loyalty points
Phe113–Lys201
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD81 Protein, N-His-SUMO

Product name ARO-P12635-100
Uniprot ID P60033
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P12635
Note For research use only.
Molecular Constructor
Phe113–Lys201
Product name ARO-P12635-1MG
Uniprot ID P60033
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P12635
Note For research use only.
Molecular Constructor
Phe113–Lys201
Product name ARO-P12635-50
Uniprot ID P60033
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight 22.11 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe113-Lys201
Aliases /Synonyms CD81 antigen, TSPAN28, Target of the antiproliferative antibody 1, Tspan-28, Tetraspanin-28, CD81, TAPA1, 26 kDa cell surface protein TAPA-1
Reference ARO-P12635
Note For research use only.
Molecular Constructor
Phe113–Lys201

Introduction to Recombinant Human CD81 Protein

Recombinant Human CD81 Protein, also known as CD81 antigen or TAPA-1, is a transmembrane protein that plays a crucial role in various cellular processes. It is encoded by the CD81 gene and is expressed on the surface of many cell types, including B cells, T cells, and natural killer cells. CD81 is a member of the tetraspanin family of proteins, which are characterized by four transmembrane domains and are involved in cell signaling, adhesion, and fusion.

Structure of Recombinant Human CD81 Protein

The recombinant form of CD81 protein is produced through genetic engineering techniques, where the CD81 gene is inserted into a suitable expression vector and then expressed in a host cell. The resulting protein is a glycosylated type I transmembrane protein with a molecular weight of approximately 26 kDa. It is composed of 236 amino acids and contains four transmembrane domains, a large extracellular loop, and short intracellular N- and C-termini.

The extracellular loop of CD81 is the most variable region of the protein and contains several potential glycosylation sites. This loop is involved in protein-protein interactions and is responsible for the diverse functions of CD81 in different cell types. The intracellular domains of CD81 are involved in signal transduction and interact with other proteins to regulate various cellular processes.

Activity of Recombinant Human CD81 Protein

CD81 is a multifunctional protein that is involved in a wide range of cellular activities. It acts as a receptor for various ligands, including the hepatitis C virus, Plasmodium falciparum, and the tetraspanin CD9. CD81 also interacts with other tetraspanins, such as CD19 and CD82, to form complexes that regulate cell adhesion, migration, and fusion.

One of the key roles of CD81 is its involvement in immune responses. It is expressed on the surface of B cells, where it plays a crucial role in B cell activation and differentiation. CD81 also acts as a co-stimulatory molecule for T cells, enhancing their proliferation and cytokine production. In addition, CD81 is involved in the regulation of natural killer cell cytotoxicity and is a potential target for cancer immunotherapy.

CD81 is also involved in the regulation of cell proliferation, survival, and apoptosis. It has been shown to interact with growth factor receptors and modulate their signaling pathways. CD81 also plays a role in the formation and maintenance of tight junctions in epithelial cells, and it is involved in the regulation of cell migration and invasion in cancer cells.

Application of Recombinant Human CD81 Protein

The recombinant form of CD81 protein has a wide range of applications in both research and clinical settings. It is commonly used as an antigen for the production of specific antibodies, which are used in various immunoassays, including Western blotting, flow cytometry, and immunohistochemistry. Recombinant CD81 protein can also be used as a ligand for various receptor-binding studies and as a tool for investigating the role of CD81 in different cellular processes.

In addition, recombinant CD81 protein has potential therapeutic applications. It has been shown to inhibit hepatitis C virus entry into cells, making it a potential treatment for hepatitis C infection. CD81-targeted therapies are also being explored for the treatment of cancer, as CD81 is overexpressed in many types of cancer cells and is involved in tumor progression and metastasis.

Conclusion

In summary, Recombinant Human CD81 Protein is a versatile and important protein that plays a crucial role in various cellular processes. Its structure, activity, and applications make it a valuable tool for research and a potential target for therapeutic interventions. Further studies on CD81 and its interactions with other

Recombinant Human CD81 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD81 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products