Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SEC22B Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O75396
Molecular weight:
20.39 kDa

Original price was: €260.00.Current price is: €230.00.

50ug 12% OFF + 230 loyalty points
Met1–Gly160
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SEC22B Protein, N-His

Product name ARO-P11932-100
Uniprot ID O75396
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRG
Molecular weight 20.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly160
Aliases /Synonyms ERS-24, SEC22B, SEC22 vesicle-trafficking protein-like 1, SEC22L1, SEC22 vesicle-trafficking protein homolog B, ERS24, ER-Golgi SNARE of 24 kDa, Vesicle-trafficking protein SEC22b
Reference ARO-P11932
Note For research use only.
Molecular Constructor
Met1–Gly160
Product name ARO-P11932-1MG
Uniprot ID O75396
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRG
Molecular weight 20.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly160
Aliases /Synonyms ERS-24, SEC22B, SEC22 vesicle-trafficking protein-like 1, SEC22L1, SEC22 vesicle-trafficking protein homolog B, ERS24, ER-Golgi SNARE of 24 kDa, Vesicle-trafficking protein SEC22b
Reference ARO-P11932
Note For research use only.
Molecular Constructor
Met1–Gly160
Product name ARO-P11932-50
Uniprot ID O75396
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRG
Molecular weight 20.39 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly160
Aliases /Synonyms ERS-24, SEC22B, SEC22 vesicle-trafficking protein-like 1, SEC22L1, SEC22 vesicle-trafficking protein homolog B, ERS24, ER-Golgi SNARE of 24 kDa, Vesicle-trafficking protein SEC22b
Reference ARO-P11932
Note For research use only.
Molecular Constructor
Met1–Gly160

Introduction

Recombinant Human SEC22B Protein, also known as SEC22 vesicle trafficking protein-like 2, is a protein that plays a crucial role in intracellular vesicle trafficking and fusion. It is a member of the SEC22 family of proteins, which are involved in the transport of proteins and lipids between different compartments of the cell. Recombinant SEC22B Protein is produced through genetic engineering techniques, making it a valuable tool for various research and therapeutic applications.

Structure of Recombinant Human SEC22B Protein

The SEC22B gene is located on chromosome 1 in humans and encodes for a protein of 232 amino acids. The recombinant version of this protein is produced by inserting the gene into a suitable expression vector and expressing it in a host cell, typically E. coli or yeast. The resulting protein is a soluble protein with a molecular weight of approximately 26 kDa.

SEC22B protein is composed of four domains: the N-terminal domain, the SNARE motif, the transmembrane domain, and the C-terminal domain. The N-terminal domain is responsible for protein-protein interactions and is essential for the fusion of vesicles. The SNARE motif, which is a conserved sequence in all SEC22 family members, is involved in the binding and fusion of vesicles. The transmembrane domain anchors the protein to the membrane, while the C-terminal domain is involved in the regulation of protein function.

Activity of Recombinant Human SEC22B Protein

Recombinant Human SEC22B Protein is involved in the transport of proteins and lipids between the endoplasmic reticulum (ER) and the Golgi apparatus. It is also involved in the fusion of transport vesicles with their target membranes, a process essential for the delivery of cargo to its destination. SEC22B protein is known to interact with other proteins involved in vesicle trafficking, such as SEC22A and SNAP23, to form a complex that mediates vesicle fusion.

Studies have shown that SEC22B protein is essential for the proper functioning of the immune system. It is involved in the transport of major histocompatibility complex (MHC) class II molecules from the ER to the endosomal compartment, where they are loaded with antigens for presentation to T cells. This process is crucial for the activation of T cells, which play a central role in the adaptive immune response.

Application of Recombinant Human SEC22B Protein

Recombinant Human SEC22B Protein has various applications in both research and therapeutic settings. Its role in vesicle trafficking makes it a valuable tool for studying the mechanisms of intracellular transport. It can be used to investigate the role of SEC22B in various cellular processes, such as protein secretion, organelle biogenesis, and cell signaling.

In the field of immunology, recombinant SEC22B protein can be used to study the role of MHC class II molecules in antigen presentation and T cell activation. It can also be used to investigate the mechanisms of immune evasion by pathogens that target the vesicle trafficking pathway.

In a therapeutic setting, SEC22B protein can be used as an antigen for the development of vaccines against infectious diseases. By presenting specific antigens to the immune system, recombinant SEC22B protein can elicit a strong immune response and provide protection against the pathogen. Additionally, SEC22B protein can be used as a target for the development of drugs that can modulate its activity, potentially leading to the treatment of immune-related disorders.

Conclusion

Recombinant Human SEC22B Protein is a crucial player in the intracellular vesicle trafficking pathway, involved in the transport and fusion of vesicles. Its structure and activity make it a valuable tool for studying various cellular processes and its role in the immune system. Its potential applications in research and therapy make it a promising protein for future studies and developments.

Recombinant Human SEC22B Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human SEC22B Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products