Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CEPT1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6K0
Molecular weight:
19.53 kDa

Original price was: €292.00.Current price is: €230.00.

50ug 21% OFF + 230 loyalty points
Ser26–Asn86
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CEPT1 Protein, N-His-SUMO

Product name ARO-P10648-100
Uniprot ID Q9Y6K0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence STTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPN
Molecular weight 19.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Asn86
Aliases /Synonyms CEPT1, Choline/ethanolaminephosphotransferase 1, hCEPT1
Reference ARO-P10648
Note For research use only.
Molecular Constructor
Ser26–Asn86
Product name ARO-P10648-1MG
Uniprot ID Q9Y6K0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence STTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPN
Molecular weight 19.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Asn86
Aliases /Synonyms CEPT1, Choline/ethanolaminephosphotransferase 1, hCEPT1
Reference ARO-P10648
Note For research use only.
Molecular Constructor
Ser26–Asn86
Product name ARO-P10648-50
Uniprot ID Q9Y6K0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence STTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPN
Molecular weight 19.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Asn86
Aliases /Synonyms CEPT1, Choline/ethanolaminephosphotransferase 1, hCEPT1
Reference ARO-P10648
Note For research use only.
Molecular Constructor
Ser26–Asn86

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of a specific protein. One such recombinant protein is the human CEPT1 protein, which has important implications in various biological processes. In this article, we will discuss the structure, activity, and applications of recombinant human CEPT1 protein.

Structure of Recombinant Human CEPT1 Protein

The human CEPT1 protein, also known as choline/ethanolaminephosphotransferase 1, is an enzyme that plays a crucial role in the synthesis of phosphatidylcholine and phosphatidylethanolamine, important components of cell membranes. The recombinant form of this protein is produced by inserting the human CEPT1 gene into a host organism, such as bacteria or yeast, and allowing it to produce the protein in large quantities.

The recombinant human CEPT1 protein has a molecular weight of approximately 45 kDa and consists of 403 amino acids. It is composed of two domains: a catalytic domain and a regulatory domain. The catalytic domain is responsible for the transfer of phosphocholine or phosphoethanolamine from CDP-choline or CDP-ethanolamine to diacylglycerol, while the regulatory domain plays a role in substrate specificity and enzyme activity.

Activity of Recombinant Human CEPT1 Protein

The primary function of the human CEPT1 protein is to catalyze the transfer of phosphocholine or phosphoethanolamine to diacylglycerol, resulting in the synthesis of phosphatidylcholine and phosphatidylethanolamine. This process is essential for the maintenance of cell membrane integrity and fluidity. Additionally, the recombinant human CEPT1 protein has been shown to have a high specificity for its substrates, making it an efficient enzyme for the production of phospholipids.

Furthermore, the activity of recombinant human CEPT1 protein can be modulated by various factors, including pH, temperature, and the presence of regulatory proteins. This allows for the fine-tuning of its activity, making it a versatile tool for various biological applications.

Applications of Recombinant Human CEPT1 Protein

The recombinant human CEPT1 protein has a wide range of applications in the field of biotechnology and medicine. One of its primary applications is in the production of phospholipids, which are used in the formulation of liposomes, a type of drug delivery system. The high specificity and efficiency of the recombinant human CEPT1 protein make it an ideal enzyme for this purpose.

Moreover, the human CEPT1 gene has been linked to various diseases, including cancer and neurological disorders. The production of recombinant human CEPT1 protein has allowed for the study of its role in these diseases and the development of potential therapeutic interventions.

Additionally, recombinant human CEPT1 protein has been used in research studies to investigate the role of phospholipids in various biological processes, such as cell signaling and membrane trafficking. Its ability to modulate phospholipid synthesis has also been utilized in the production of biofuels from microalgae.

Conclusion

In summary, recombinant human CEPT1 protein is a crucial enzyme involved in the synthesis of phospholipids and has numerous applications in biotechnology and medicine. Its structure, activity, and modulability make it a valuable tool for studying biological processes and developing potential treatments for diseases. Further research on this protein could lead to advancements in various

Recombinant Human CEPT1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CEPT1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products