Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Emiltatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade

  • PX-TA2189-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €196.00.Current price is: €140.00.

50ug 29% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Emiltatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade

Product name PX-TA2189-50
Uniprot ID Q7Z7D3
Source CAS: 2855971-15-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA2189-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Emiltatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2855971-15-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA2189-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Product name Emiltatug Biosimilar - Anti-V-set domain-containing T-cell activation inhibitor 1 mAb - Research Grade
Uniprot ID Q7Z7D3
Source CAS: 2855971-15-0
Origin species Human
Expression system XtenCHO
Raw Antigen Sequence MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK
Purity >95% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-V-set domain-containing T-cell activation inhibitor 1, B7h.5, B7 homolog 4, B7-H4, T-cell costimulatory molecule B7x, B7H4, VTCN1, Protein B7S1, Immune costimulatory protein B7-H4
Reference PX-TA2189-100
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Emiltatug Biosimilar is a therapeutic antibody that specifically targets the V-set domain-containing T-cell activation inhibitor 1 (VISTA) protein. This monoclonal antibody (mAb) has been developed as a research grade product and has shown promising results in pre-clinical studies. In this article, we will discuss the structure, activity, and potential applications of Emiltatug Biosimilar in the field of immunotherapy.

Structure of Emiltatug Biosimilar

Emiltatug Biosimilar is a recombinant humanized IgG1 monoclonal antibody that has been engineered to specifically target VISTA. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable regions of the heavy and light chains are responsible for binding to the target protein, while the constant regions provide stability and effector functions.

The amino acid sequence of Emiltatug Biosimilar has been carefully designed to mimic the natural human antibody structure and minimize immunogenicity. This ensures that the antibody is well-tolerated and does not elicit an immune response when administered to patients.

Activity of Emiltatug Biosimilar

Emiltatug Biosimilar works by binding to VISTA, a cell surface protein that is expressed on various immune cells, including T cells, myeloid cells, and dendritic cells. VISTA is known to play a role in regulating immune responses and is often overexpressed in cancer cells, leading to immune evasion and tumor progression.

By targeting VISTA, Emiltatug Biosimilar blocks its inhibitory function and allows for the activation of immune cells, leading to enhanced anti-tumor immune responses. This mechanism of action has been demonstrated in pre-clinical studies, where Emiltatug Biosimilar has shown to inhibit tumor growth and improve survival rates in animal models.

Potential Applications of Emiltatug Biosimilar

Emiltatug Biosimilar has the potential to be used in various therapeutic applications, particularly in the field of cancer immunotherapy. As VISTA is overexpressed in many types of cancer, Emiltatug Biosimilar can be used to target and inhibit its function, leading to enhanced anti-tumor immune responses.

In addition to cancer, VISTA has also been implicated in other diseases such as autoimmune disorders and chronic infections. Therefore, Emiltatug Biosimilar may also have potential applications in these areas, either as a monotherapy or in combination with other treatments.

Conclusion

In summary, Emiltatug Biosimilar is a promising therapeutic antibody that targets the immune checkpoint protein VISTA. Its carefully designed structure and specific activity make it a potential candidate for the treatment of various diseases, particularly cancer. Further clinical studies are needed to fully evaluate the efficacy and safety of Emiltatug Biosimilar, but it holds great potential in the field of immunotherapy.

Keywords: Emiltatug Biosimilar, therapeutic antibody, VISTA, immunotherapy, cancer, immune checkpoint.

SDS-PAGE for Emiltatug Biosimilar - Research Grade

SDS-PAGE for Emiltatug Biosimilar - Research Grade

Emiltatug Biosimilar - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Emiltatug Biosimilar - Research Grade in ELISA Assay

Emiltatug Biosimilar - Research Grade in ELISA Assay

Emiltatug Biosimilar - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

There are no reviews yet.

Be the first to review “Emiltatug Biosimilar – Anti-V-set domain-containing T-cell activation inhibitor 1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products