Cart (0 Items)
Your cart is currently empty.
View ProductsA. thaliana AteIF4E1 Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | A. thaliana AteIF4E1 Recombinant Protein |
|---|---|
| Uniprot ID | O23252 |
| Uniprot link | http://www.uniprot.org/uniprot/O23252 |
| Origin species | A. thaliana |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA |
| Molecular weight | 28,76 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | >90% |
| Buffer | PBS, imidazole 300mM, pH7,4 |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Full-length |
| Protein Accession | NP_193538.1 |
| Spec:Entrez GeneID | 827529 |
| Spec:NCBI Gene Aliases | AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1 |
| Spec:SwissProtID | O23252 |
| NCBI Reference | NP_193538.1 |
| Aliases /Synonyms | AteIF4E1, translation initiation factor eIF-4E |
| Reference | PX-P1072 |
| Note | For research use only |
Reviews
Il n’y a pas encore d’avis.