Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD223 Recombinant Protein |
---|---|
Uniprot ID | P18627 |
Uniprot link | http://www.uniprot.org/uniprot/P18627 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL |
Molecular weight | 60kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1-Leu450 |
Aliases /Synonyms | LAG3 |
Reference | PX-P4110 |
Note | For research use only |
Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind to Ieramilimab Biosimilar - Anti-LAG3 mAb (cat. No.PX-TA1562) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Reviews
Il n’y a pas encore d’avis.