Cart (0 Items)
Your cart is currently empty.
View ProductsCD278 Recombinant Protein
| Size | 100ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | CD278 Recombinant Protein |
|---|---|
| Uniprot ID | Q9Y6W8 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9Y6W8 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK |
| Molecular weight | 45kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Met1~ Lys140 |
| Protein Accession | Q9Y6W8 |
| Spec:Entrez GeneID | 29851 |
| Spec:NCBI Gene Aliases | AILIM; CD278; CVID1 |
| Spec:SwissProtID | Q8N6W8 |
| NCBI Reference | Q9Y6W8 |
| Aliases /Synonyms | AILIM |
| Reference | PX-P4116 |
| Note | For research use only |
Related products
Biosimilar
Reviews
Il n’y a pas encore d’avis.