Cart (0 Items)
Your cart is currently empty.
View ProductsCD40 Recombinant Protein
| Size | 100ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | CD40 Recombinant Protein |
|---|---|
| Uniprot ID | P25942 |
| Uniprot link | http://www.uniprot.org/uniprot/P25942 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Molecular weight | 22.32kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Met1~Arg193 |
| Aliases /Synonyms | TNFRSF5 |
| Reference | PX-P4082 |
| Note | For research use only |
Description of CD40 Recombinant Protein
General information on CD40 Recombinant Protein:
CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily, which is a single transmembrane glycoprotein. The CD40 protein plays a vital role in mediating a variety of immune and inflammatory responses, including the change in class T that depends on the type of immunoglobulin, the development of B cell memory and the formation of reproductive centers. The CD40 protein is expressed in B cells, dendritic cells, macrophages, endothelial cells and some tumor cells. CD40 deficiency can lead to high IgM type 3 (HIGM3) immunodeficiency. In addition, β-amyloid-induced microglia activation requires CD40 / CD40L interaction and is therefore considered an early event in the pathogenesis of Alzheimer’s disease.
Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay
Immobilized CD40 Recombinant Protein (cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind to Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb (cat. No.PX-TA1503) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Biosimilar
Teneliximab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade
PX-TA1196 400€
Biosimilar
Bleselumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade
PX-TA1393 400€
Biosimilar
Selicrelumab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade
PX-TA1465 400€
Biosimilar
Iscalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade
PX-TA1503 400€
Biosimilar
Mitazalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade
PX-TA1515 400€
Biosimilar
Vanalimab Biosimilar – Anti-CD40 mAb – Research Grade
PX-TA1735 400€
Biosimilar
Tecaginlimab Biosimilar – Anti-CD40 & CD137 mAb – Research Grade
PX-TA1777 400€
Biosimilar
Cifurtilimab Biosimilar – Anti-CD40 mAb – Research Grade
PX-TA1825 400€
Biosimilar
Frexalimab Biosimilar – Anti-CD40LG mAb – Research Grade
PX-TA1842 400€
Biosimilar
Giloralimab Biosimilar – Anti-CD40 mAb – Research Grade
PX-TA1845 400€
Biosimilar
Inezetamab Biosimilar – Anti-CD40;MSLN mAb – Research Grade
PX-TA1849 400€
Biosimilar
Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade
PX-TA1925 400€
Ligand
Reviews
Il n’y a pas encore d’avis.