Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD47 Protein - Mus musculus Leukocyte surface antigen CD47 recombinant protein |
---|---|
Uniprot ID | Q61735 |
Uniprot link | http://www.uniprot.org/uniprot/Q61735 |
Origin species | House Mouse |
Expression system | Eukaryotic expression |
Sequence | MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKIGSHHHHHH |
Molecular weight | 18.85kDa |
Protein delivered with Tag? | C-His Tag |
Purity estimated | 80% |
Buffer | 50mM Tris-HCl pH 7.0, 150mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1~Ile162 |
Aliases /Synonyms | CD47, MER6, OA3, Antigen Identified By Monoclonal Antibody 1D8, Antigenic Surface Determinant Protein OA3, Rh-Related Antigen |
Reference | PX-P4009 |
Note | For research use only |
CD47 also known as Cluster of Differentiation 47 or Integrins Associated Protein (IAP) is a transmembrane protein coded by CD47 gene in humans. CD47 protein consists of an extracellular N-terminal domain, a short C-terminal intracellular tail and five transmembrane domains. There are four alternatively spliced isoforms of CD47 protein based in the length of their cytoplasmic tail. This protein is key element in immune response. More precisely CD47 protein functions as a ‘don’t eat me’ signal for the macrophages and is often over-expressed in tumor cells. Indeed, high levels of CD47 protein allows cancer cells to avoid phagocytosis despite regardless of calreticulin levels (the dominant pro-phagocytic signal). CD47 protein is also involved in angiogenic response by regulating the activity of VEGF in T Cells. CD47 protein is involved in memory formation and synaptic plasticity in hippocampus. CD47 is very broadly distributed in normal adult tissues. However, CD47 protein especially abundant in some epithelia.
CD47 protein has a high affinity for thrombospondin-1 (TSP-1) ligand which is a glycoprotein involved in angiogenesis. CD47-TSP1 binding influences angiogenesis as well as other fundamental cell functions such as cell migration, proliferation and apoptosis. CD47 protein also interacts with signal-regulatory protein alpha (SIRPα) which is an inhibitory transmembrane receptor located on myeloid cells. The interaction between SIRPα and CD47 protein results in different cell-to-cell responses such as inhibition of phagocytosis, T-cell activation and stimulation of cell-cell fusion. Furthermore, CD47 protein partners with the integrins, most commonly integrin αVβ3. The integrin αVβ3/ CD47 complex is essential for the transmigration of neutrophils and monocytes through the endothelium. The CD47/integrin interactions affects a range of cell functions such as adhesion, spreading and migration. CD47/ integrin complex may be involved in membrane transport and/or integrin dependent signal transduction. It has also been suggested that Cd47 protein may prevent premature elimination of erythrocytes.
Related products
Reviews
Il n’y a pas encore d’avis.