Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD47 Recombinant Protein (Human) |
---|---|
Uniprot ID | Q08722 |
Uniprot link | http://www.uniprot.org/uniprot/Q08722 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDK SDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE |
Molecular weight | 35kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
Storage condition | Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1~Glu141 |
Aliases /Synonyms | MER6 |
Reference | PX-P4083 |
Note | For research use only. |
CD47 (Cluster of Differentiation 47), also known as the integrin associated protein (IAP), is a transmembrane protein which is encoded by the CD47 gene in humans. CD47 belongs to the immunoglobulin superfamily and binds to membrane integrins, as well as thrombospondin 1 (TSP-1) ligands and α signal regulatory protein (SIRPα).
CD47 is involved in a variety of cellular processes, including apoptosis, proliferation, adhesion, and migration. In addition, it plays a key role in immune and angiogenic reactions. CD47 is commonly expressed in human cells and has been shown to overexpress in many different tumor cells. It is also expressed in assorted cranial tumors.
CD47 is a membrane receptor with an extracellular N-terminal IgV domain, five transmembrane domains, and a short, C-terminal intracellular tail.
Related products
Reviews
Il n’y a pas encore d’avis.