Cart (0 Items)
Your cart is currently empty.
View ProductsCD80 Recombinant Protein
| Size | 100ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | CD80 Recombinant Protein |
|---|---|
| Uniprot ID | P33681 |
| Uniprot link | http://www.uniprot.org/uniprot/P33681 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN |
| Molecular weight | 45kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Met1~Asn242 |
| Aliases /Synonyms | CD28LG, CD28LG1, LAB7 |
| Reference | PX-P4090 |
| Note | For research use only |
Description of CD80 Recombinant Protein
General information on CD80 Recombinant Protein:
Cluster of Differentiation 80, also known as B7-1, is a member of the cell surface immunoglobulin superfamily. It is expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. CD80 plays a fundamental but different role in the activation of T cells. B7-1 / CD80 and B7-2 / CD86 and its CD28 and CTLA4 receptors constitute one of the main co-stimulatory pathways that regulate the response of T and B cells. CD80 is mainly expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. Although CTLA-4 and CD28 can bind to the same ligand, CTLA-4 binds B7-1 and B7-2 with an affinity 20-100 times greater than CD28 and participates in the negative regulation of immune responses. Therefore, CD80 is considered a promising therapeutic target for autoimmune diseases and various types of cancer.
Related products
Biosimilar
Homo sapiens Biosimilar – Anti-CD80 (B7-1,CD28LG2) mAb – Research Grade
PX-TA1111 400€
Biosimilar
Reviews
Il n’y a pas encore d’avis.