Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 200ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Dog Programmed death ligand 1(PDL1)-CD274 Recombinant Protein |
---|---|
Uniprot ID | E2RKZ5 |
Uniprot link | http://www.uniprot.org/uniprot/E2RKZ5 |
Origin species | Dog |
Expression system | Eukaryotic expression |
Sequence | MRMFSVFTFMAYCHLLKAFTITVSKDLYVVEYGGNVTMECKFPVEKQLNLFALIVYWEMEDKKIIQFVNGKEDLKVQHSSYSQRAQLLKDQLFLGKAALQITDVRLQDAGVYCCLIGYGGADYKRITLKVHAPYRNISQRISVDPVTSEHELMCQAEGYPEAEVIWTSSDHRVLSGKTTITNSNREEKLFNVTSTLNINATANEIFYCTFQRSGPEENNTAELVIPERLPVPASERTHGSHHHHHH |
Molecular weight | 25.94 kDa |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 2-3 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
NCBI Reference | E2RKZ5 |
Biological activity | Measured by its binding ability in a functional ELISA. Immobilized human PD-1 at 5ug/ml (100ul/well)can bind recombinant human B7-H1/PD-L1/His chimera with a liner range of 0.02~1.2ug/ml. |
Aliases /Synonyms | CD274, PDL1, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1,Programmed Cell Death Protein 1 Ligand 1, PDCD1LG1 |
Reference | PX-P3014 |
Note | For research use only |
Programmed death-ligand 1 (PD-L1) also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1) and programmed cell death 1 ligand 1 (PDCD1L1) is a part of the growing B7 family of immune proteins that provide signals for both stimulating and inhibiting T cell activation. It play a main role in suppressing the immune system during some events such as tissue allografts, pregnancy, autoimmune disorder and other disease states such as hepatitis.
Related products
Reviews
Il n’y a pas encore d’avis.