Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human Human DCLK3 partial (162-632) Recombinant Protein |
---|---|
Uniprot ID | Q9C098 |
Uniprot link | http://www.uniprot.org/uniprot/Q9C098 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGSELDMGKGPMYDVEKLVRTRSCRRSPEANPASGEEGWKGDSHRSSPRNPTQELRRPSKSMDKKEDRGPEDQESHAQGAAKAKKDLVEVLPVTEEGLREVKKDTRPMSRSKHGGWLLREHQAGFEKLRRTRGEEKEAEKEKKPCMSGGRRMTLRDDQPAKLEKEPKTRPEENKPERPSGRKPRPMGIIAANVEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDKSRLKGKEDMVDSEILI |
Molecular weight | 54.83kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 30% |
Buffer | PBS, pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Partial |
Protein Accession | NP_208382.1 |
Spec:Entrez GeneID | 85443 |
Spec:NCBI Gene Aliases | DCAMKL3, DCDC3C, DCK3, CLR |
Spec:SwissProtID | Q9C098 |
NCBI Reference | NP_208382.1 |
Aliases /Synonyms | Human DCLK3 partial (162-632), doublecortin-like kinase 3, Serine/threonine-protein kinase DCLK3 ou Doublecortin domain-containing protein 3C ou Doublecortin-like and CAM kinase-like 3 ou Doublecortin-like kinase 3 |
Reference | PX-P2075 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.