Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human TIVAMP Human Recombinant Protein |
---|---|
Uniprot ID | P51809 |
Uniprot link | http://www.uniprot.org/uniprot/P51809 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MASWSHPQFEKGALEVLFQGPGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQD RIVYLCITDDDFERSRAFIFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKG IMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKALVPRGSSAHHHHHHHHHHH |
Molecular weight | 26,11 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | NaH2PO4 100mM, TrisHCl 10mM, Urea 8M |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Partial |
Protein Accession | NP_005629.1 |
Spec:Entrez GeneID | 6845 |
Spec:NCBI Gene Aliases | SYBL1, TI-VAMP, VAMP-7, TIVAMP |
Spec:SwissProtID | P51809 |
NCBI Reference | NP_005629.1 |
Aliases /Synonyms | TIVAMP Human, vesicle-associated membrane protein 7 isoform 1 |
Reference | PX-P1161 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.