Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human VEGF Recombinant Protein |
---|---|
Uniprot ID | P15692 |
Uniprot link | http://www.uniprot.org/uniprot/P15692 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MAHNHRHKHKLDDDDKAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR |
Molecular weight | 14,65 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 70% |
Buffer | PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Partial |
Protein Accession | AAH65522.2 |
Spec:Entrez GeneID | 7422 |
Spec:NCBI Gene Aliases | MVCD1, VPF, VEGF |
Spec:SwissProtID | P15692 |
NCBI Reference | AAH65522.2 |
Aliases /Synonyms | VEGF, VEGFA protein, Vascular endothelial Growth Factor proteins A, VEGF-A, Vascular permeability factor, VPF, VEGFA |
Reference | PX-P1060 |
Note | For research use only. |
Publication
Related products
Your cart is currently empty.
View Products
Reviews
Il n’y a pas encore d’avis.