Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein |
---|---|
Uniprot ID | O75144 |
Uniprot link | http://www.uniprot.org/uniprot/O75144 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSGSHHHHHH |
Molecular weight | 29.56kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | ICOSL protein is stored:At 4°C for short term period (less than a week) At -20°C or -80°C for long term period RecommendationsIt is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
Aliases /Synonyms | CD275, B7-H2, B7H2, B7RP-1, B7RP1, GL50, ICOS-L, ICOSL, LICOS, B7-like protein Gl50, B7-related protein 1 |
Reference | PX-P4032 |
Note | For research use only |
ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing
Related products
Reviews
Il n’y a pas encore d’avis.