Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | IGFBP1 protein - Human IGFBP1 full length Recombinant Protein |
---|---|
Uniprot ID | P08833 |
Uniprot link | http://www.uniprot.org/uniprot/P08833 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYF |
Molecular weight | 28.74kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 95% |
Buffer | PBS, pH 7.5 with 0.2mM β-Met and glycerol 2.5% |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Full-length |
Protein Accession | ACO37638.1 |
Spec:Entrez GeneID | 3484 |
Spec:NCBI Gene Aliases | hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25 |
Spec:SwissProtID | P08833 |
NCBI Reference | ACO37638.1 |
Aliases /Synonyms | IGFBP1 full length, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1 |
Reference | PX-P2077 |
Note | For research use only |
Reviews
Il n’y a pas encore d’avis.