Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Interleukin-17A(IL17A) |
---|---|
Uniprot ID | Q16552 |
Uniprot link | https://www.uniprot.org/uniprot/Q16552 |
Expression system | Eukaryotic expression |
Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGSHHHHHH |
Molecular weight | 18.5kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >60% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1-Ala155 |
Protein Accession | Q16552 |
Spec:Entrez GeneID | 3605 |
Spec:NCBI Gene Aliases | IL17; CTLA8; IL-17; CTLA-8; IL-17A |
Spec:SwissProtID | Q5T2P0 |
NCBI Reference | Q16552 |
Aliases /Synonyms | Cytotoxic T-lymphocyte-associated antigen 8,CTLA-8,CTLA8, IL17,IL-17, IL-17A |
Reference | PX-P4824 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.