Cart (0 Items)
Your cart is currently empty.
View ProductsReceptor-interacting serine, threonine-protein kinase 4(RIPK4)
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | Receptor-interacting serine, threonine-protein kinase 4(RIPK4) |
|---|---|
| Uniprot ID | P57078 |
| Uniprot link | https://www.uniprot.org/uniprot/P57078 |
| Expression system | Prokaryotic expression |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELLEEAKKMEMAKFRYILPVYGICREPVGLVMEYMETGSLEKLLASEPLPWDLRFRIIHETAVGMNFLHCMAPPLLHLDLKPANILLDAHYHVKISDFGLAKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHIMVKVVKGHRPELPPVCRARPRACSHLIRLMQRCWQGDPRVRPTFQGNGLNGELI |
| Molecular weight | 57.6kDa |
| Protein delivered with Tag? | N-terminal GST Tag |
| Purity estimated | >80% by SDS-PAGE |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Phe22-Ile286 |
| Protein Accession | P57078 |
| Spec:SwissProtID | Q96KH0 |
| NCBI Reference | P57078 |
| Aliases /Synonyms | ANKRD3, DIK，Ankyrin repeat domain-containing protein 3，PKC-delta-interacting protein kinase |
| Reference | PX-P4863 |
| Note | For research use only |
Related products
Tag Antibody
Reviews
Il n’y a pas encore d’avis.