Cart (0 Items)
Your cart is currently empty.
View ProductsToxoplasma gondii GRA6Ct(174-230)(C56) Recombinant Protein
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | Toxoplasma gondii GRA6Ct(174-230)(C56) Recombinant Protein |
|---|---|
| Origin species | Toxoplasma gondii |
| Expression system | Prokaryotic expression |
| Sequence | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTTGRRSPPEPSPDGSGDGGGNDAGNNAGNRGNEGRGYGDRGEG GGEDDRRALHPERVNVFDYKLAAALEHHHHHH |
| Molecular weight | 11,99 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Partial |
| Protein Accession | /* |
| NCBI Reference | /* |
| Aliases /Synonyms | GRA6Ct(174-230)(C56), dense granule antigen |
| Reference | PX-P1099 |
| Note | For research use only |
Reviews
Il n’y a pas encore d’avis.