Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Volume-regulated anion channel subunit LRRC8D (Lrrc8d) |
---|---|
Uniprot ID | Q5U308 |
Uniprot link | https://www.uniprot.org/uniprot/Q5U308 |
Expression system | Prokaryotic expression |
Sequence | MGPEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLTKVPSNITDVAPHLGSHHHHHH |
Molecular weight | 14.1kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >75% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Pro501-Leu613 |
Protein Accession | Q5U308 |
Spec:Entrez GeneID | 305131 |
Spec:SwissProtID | Q5U308 |
NCBI Reference | Q5U308 |
Aliases /Synonyms | Leucine-rich repeat-containing protein 5,Leucine-rich repeat-containing protein 8D,Lrrc5 |
Reference | PX-P4696 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.