Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Zika ZGE Recombinant Protein-Genome polyprotein |
---|---|
Uniprot ID | A0A140E7U5 |
Uniprot link | http://www.uniprot.org/uniprot/A0A140E7U5 |
Origin species | Zika |
Expression system | Prokaryotic expression |
Sequence | MIRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTAMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMLVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLAHKEWFHDIPLPWHAGAATGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETVDGTVTVEGQYGGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIIGAAFKLEHHHHHH |
Molecular weight | 54.6 kDa |
Purity estimated | 85% |
Buffer | PBS,pH7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Partial |
Aliases /Synonyms | ZGE, Genome polyprotein |
Reference | PX-P3065 |
Note | For research use only |
The genome of Zika virus encodes a single polyprotein that is co- and post-translationally cleaved to generate 13 proteins. For example the peptide pr prevents premature fusion activity of envelope proteins in trans Golgi by binding to envelope protein E at pH6.0. After virion release in extracellular space gets dissociated from E dimers. Non-structural protein 4A induces host endoplasmic regulate the ATPase activity of the NS3 helicase. Non-structural protein 1 is implicated in immune evasion, pathogenesis and viral replication. Once cleaved off the polyprotein is targeted to three destinations: the viral replication cycle, the plasma membrane and the extracellular compartment. It may play a role in viral genome replication etc.
Reviews
Il n’y a pas encore d’avis.