Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | A. thaliana AteIF4E1 Recombinant Protein |
---|---|
Uniprot ID | O23252 |
Uniprot link | http://www.uniprot.org/uniprot/O23252 |
Origin species | A. thaliana |
Expression system | Prokaryotic expression |
Sequence | MGSSHHHHHHSSGLVPRGSHMMAVEDTPKSVVTEEAKPNSIENPIDRYHEEGDDAEEGEIAGGEGDGNVDESSKSGVPES HPLEHSWTFWFDNPAVKSKQTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKW TMTFPKEKSDKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWKEFLDYNNSIGFIIH EDAKKLDRNAKNAYTA |
Molecular weight | 28,76 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | >90% |
Buffer | PBS, imidazole 300mM, pH7,4 |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Full-length |
Protein Accession | NP_193538.1 |
Spec:Entrez GeneID | 827529 |
Spec:NCBI Gene Aliases | AT.EIF4E1, eIF4E1, ARABIDOPSIS THALIANA EUKARYOTIC TRANSLATION INITATION FACTOR 4E1, CUCUMOVIRUS MULTIPLICATION 1, eukaryotic translation initiation factor 4E, EUKARYOTIC TRANSLATION INITATION FACTOR 4E, F15J5_10, F15J5.10, eukaryotic translation Initiation Factor 4E1, CUM1 |
Spec:SwissProtID | O23252 |
NCBI Reference | NP_193538.1 |
Aliases /Synonyms | AteIF4E1, translation initiation factor eIF-4E |
Reference | PX-P1072 |
Note | For research use only |
Your cart is currently empty.
View Products
Reviews
Il n’y a pas encore d’avis.