Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD120a Recombinant Protein |
---|---|
Uniprot ID | P19438 |
Uniprot link | http://www.uniprot.org/uniprot/P19438 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT |
Molecular weight | 30kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1~Thr211 |
Aliases /Synonyms | TNFAR, TNFR1 |
Reference | PX-P4100 |
Note | For research use only |
CD120a Recombinant Protein is a type I transmembrane glycoprotein, also known as tumor necrosis factor receptor (TNFR). It is composed of an extracellular domain, a transmembrane domain, and an intracellular domain.
CD120a is an antibody-drug target for the treatment of various diseases, such as autoimmunity, cancer, and chronic inflammation. It is involved in the regulation of cytokine proteins, including TNF, which are involved in inflammation and immune response.
CD120a Recombinant Protein is used in research and drug development for the treatment of various diseases. It can be used to study the structure and function of the TNFR and to develop drugs that target this receptor. Additionally, it can be used to study the mechanism of action of cytokines and their role in inflammation and immunity.
Reviews
Il n’y a pas encore d’avis.