Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD152 Recombinant Protein |
---|---|
Uniprot ID | P16410 |
Uniprot link | http://www.uniprot.org/uniprot/P16410 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD |
Molecular weight | 18.51kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1~Asp161 |
Aliases /Synonyms | CD152 |
Reference | PX-P4108 |
Note | For research use only |
CD152, also known as CTLA4 and cytotoxic T lymphocyte protein 4, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor. The ligands or counterreceptors of these two proteins belong to the B7, CD8 (B7-1) and CD86 (B7-2) families. CTLA4 delivers inhibitory signals to T lymphocytes, while CD28 delivers stimulatory signals. Intracellular CTLA4 is also present in regulatory T cells and may play an important role in its function. CD152 antigen or cytotoxic T lymphocytes (CTLA-4) are important receptors involved in downregulating T-cell activation. Due to its far-reaching inhibitory effect, CD152 is considered a candidate solid acceptable for autoimmunity and a convincing target for cancer immunotherapy. In particular, recent evidence suggests that CD152 is also important in homeostasis and the function of population suppressor cells called regulatory T cells (Treg).
Immobilized CD152 Recombinant Protein (cat. No.PX-P4108) at 0.5µg/mL (100µL/well) can bind to Tremelimumab Biosimilar - Anti-CTLA4, CD152 mAb (cat. No.PX-TA1177) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Your cart is currently empty.
View Products
Reviews
Il n’y a pas encore d’avis.