Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD270 Recombinant Protein |
---|---|
Uniprot ID | Q92956 |
Uniprot link | http://www.uniprot.org/uniprot/Q92956 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWV |
Molecular weight | 36kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Met1~Val202 |
Protein Accession | Q92956 |
Spec:Entrez GeneID | 8764 |
Spec:NCBI Gene Aliases | TR2; ATAR; HVEA; HVEM; CD270; LIGHTR |
Spec:SwissProtID | Q6IB95 |
NCBI Reference | Q92956 |
Aliases /Synonyms | HVEA, HVEM,TR2 |
Reference | PX-P4113 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.