Cart (0 Items)
Your cart is currently empty.
View ProductsCD276 Recombinant Protein
| Size | 100ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | CD276 Recombinant Protein |
|---|---|
| Uniprot ID | Q5ZPR3 |
| Uniprot link | http://www.uniprot.org/uniprot/Q5ZPR3 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT |
| Molecular weight | 70kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >95% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Met1-Thr461 |
| Aliases /Synonyms | B7H3, PSEC0249, UNQ309/PRO352 |
| Reference | PX-P4125 |
| Note | For research use only |
Description of CD276 Recombinant Protein
General information on CD276 Recombinant Protein:
CD276, also known as B7-H3, is a member of the B superfamily and has IgV and IgG regions in the extracellular domain. It is a type I transmembrane protein with 20-27% amino acid identity to other members of the B7 family. B7-H3 participates in the activation of T lymphocytes and regulates the formation of mouse bone. It has also been reported that B7-H3 may play an important role in muscle-immune interaction, providing further evidence for the active role of muscle cells in the local immune regulation process. B7-H3 is expressed on T cells, natural lethal cells and antigenic cells, and certain non-immune cells (such as osteoblasts, fibroblasts, fibroblast-like synovial cells, and epithelial cells). The high expression of B7-H3 in the tumor vasculature also indicates poor patient survival, indicating that it may play a role in the migration of tumor cells.
Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb binds to CD276 Recombinant Protein in indirect ELISA Assay
Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind to Enoblituzumab Biosimilar - Anti-CD276, B7-H3 mAb (cat. No.PX-TA1410) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Biosimilar
Enoblituzumab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade
PX-TA1410 400€
Biosimilar
Omburtamab Biosimilar – Anti-CD276, B7-H3, B7RP-2 mAb – Research Grade
PX-TA1532 400€
Biosimilar
Mirzotamab Biosimilar – Anti-CD276, B7-H3 mAb – Research Grade
PX-TA1596 400€
Biosimilar
Obrindatamab Biosimilar – Anti-CD276;CD3E mAb – Research Grade
PX-TA1692 400€
Biosimilar
Ifinatamab Biosimilar – Anti-CD276 mAb – Research Grade
PX-TA1847 400€
Biosimilar
Vobramitamab Biosimilar – Anti-CD276 mAb – Research Grade
PX-TA1890 400€
Monoclonal Antibody
Reviews
Il n’y a pas encore d’avis.