Cart (0 Items)
Your cart is currently empty.
View ProductsCD279 Recombinant Protein
| Size | 100ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | CD279 Recombinant Protein |
|---|---|
| Uniprot ID | Q15116 |
| Uniprot link | http://www.uniprot.org/uniprot/Q15116 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV |
| Molecular weight | 40kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Met1~Val170 |
| Aliases /Synonyms | PD1 |
| Reference | PX-P4117 |
| Note | For research use only |
Description of CD279 Recombinant Protein
General information on CD279 Recombinant Protein:
CD279 (programmed cell death protein 1; PD-1) is a type I transmembrane protein that belongs to the CD28 / CTLA-4 family of immune receptors, which mediates signals that regulate immune responses. Members of the CD28 / CTLA-4 family have been shown to promote T cell activation (CD28 and ICOS) or deactivate T cell activation (CTLA-4 and PD-1). CD279 is expressed on activated T cells, B cells, bone marrow cells, and some thymocytes. In vitro, CD279 binding can prevent TCR-mediated T cell proliferation and the production of IL-1, IL-4, IL-10, and IFN-γ. Furthermore, the binding of CD279 can also prevent BCR signaling. CD279-deficient mice have defective peripheral tolerance and spontaneously develop autoimmune diseases.
Nivolumab Biosimilar - Anti-PD1 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay
Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Nivolumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1004) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Biosimilar
Nivolumab Biosimilar – Anti-PD1 mAb – Research Grade
PX-TA1004 300€
Biosimilar
Pembrolizumab Biosimilar – Anti-PD1 mAb – Research Grade
PX-TA1007 300€
Biosimilar
Gilvetmab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1467 400€
Biosimilar
Tislelizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1479 400€
Biosimilar
Spartalizumab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1483 300€
Biosimilar
Cetrelimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1513 400€
Biosimilar
Budigalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1523 400€
Biosimilar
Cemiplimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1524 400€
Biosimilar
Dostarlimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1526 400€
Biosimilar
Prolgolimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1533 400€
Biosimilar
Sintilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1536 400€
Biosimilar
Toripalimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1540 400€
Biosimilar
Balstilimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1558 400€
Biosimilar
Retifanlimab Biosimilar – Anti-PDCD1, PD1, CD279 mAb – Research Grade
PX-TA1603 400€
SIL
Stable Isotope Labeled Nivolumab Biosimilar – Anti-PD1 mAb – Research Grade
PX-TA1004-SIL 15000€
Monoclonal Antibody
Human CD279/PDCD1/PD1 (ANB-011) Monoclonal Antibody
FHH02230 330€
Monoclonal Antibody
Anti-Human CD279/PDCD1/PD1 Nanobody (SAA1280)
PTX18973 380€
Ligand
Reviews
Il n’y a pas encore d’avis.