Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | CD40 ligand(CD40LG) |
---|---|
Uniprot ID | P29965 |
Uniprot link | https://www.uniprot.org/uniprot/P29965 |
Expression system | Prokaryotic expression |
Sequence | MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH |
Molecular weight | 18kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >80% by SDS-PAGE |
Buffer | PBS, pH7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Glu108-Leu261 |
Protein Accession | P29965 |
Spec:Entrez GeneID | 959 |
Spec:NCBI Gene Aliases | IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L |
NCBI Reference | P29965 |
Aliases /Synonyms | CD40-L,T-cell antigen Gp39,TNF-related activation protein,TRAP,Tumor necrosis factor ligand superfamily member 5,CD_antigen: CD154,CD40L, TNFSF5, TRAP |
Reference | PX-P4855 |
Note | For research use only |
Immobilized CD40 ligand(CD40LG) (cat. No.PX-P4855) at 0.5µg/mL (100µL/well) can bind to Letolizumab Biosimilar - Anti-CD40LG, CD154 mAb (cat. No.PX-TA1459) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450
Related products
Reviews
Il n’y a pas encore d’avis.