Cart (0 Items)
Your cart is currently empty.
View ProductsCD70 antigen (CD70)
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | CD70 antigen (CD70) |
|---|---|
| Uniprot ID | P32970 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGSHHHHHHSGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Applications | ELISA,WB |
| Fragment Type | Gln39-Pro193 |
| Aliases /Synonyms | CD27 ligand,CD27-L,Tumor necrosis factor ligand superfamily member 7,CD70,CD27L, CD27LG, TNFSF7 |
| Reference | PX-P4642 |
| Note | For research use only |
Related products
Biosimilar
Vorsetuzumab Biosimilar – Anti-CD70, TNFSF7 mAb – Research Grade
PX-TA1304 400€
Biosimilar
Reviews
Il n’y a pas encore d’avis.