Cart (0 Items)
Your cart is currently empty.
View ProductsDNA repair protein RAD51 homolog 2(Rad51b)
| Size | 100ug, 50ug |
|---|---|
| Brand | |
| Product type | |
| Host Species | |
| Applications |
| Product name | DNA repair protein RAD51 homolog 2(Rad51b) |
|---|---|
| Uniprot ID | O35719 |
| Uniprot link | https://www.uniprot.org/uniprot/O35719 |
| Origin species | House Mouse |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGMSVLATLPTSLGGLEGAVVYIDTESAFTAERLVEIAESRFPQYFNTEEKLLLTSSRVHLCRELTCEGLLQRLESLEEEIISKGVKLVIVDSIASVVRKEFDPKLQGNIKERNKFLGKGASLLKYLAGEFSIPVILTNQITTHLSGALPSQADLVSPADDLSLSEGTSGSSCLVAALGNTWGHCVNTRLILQYLDSERRQILIAKSPLAAFTSFVYTIKGEGLVLQGHERP |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Met121-Pro350 |
| Aliases /Synonyms | R51H2,RAD51 homolog B,RAD51-like protein 1,Rad51l1, Rec2 |
| Reference | PX-P4811 |
| Note | For research use only |
Reviews
Il n’y a pas encore d’avis.