Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Galectin-9(LGALS9) |
---|---|
Uniprot ID | O00182-2 |
Uniprot link | https://www.uniprot.org/uniprot/O00182 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYI SFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAV DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
Molecular weight | 61.76kDa |
Protein delivered with Tag? | N-terminal Fc Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5 |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Ala2-Thr323 |
Protein Accession | O00182 |
Spec:Entrez GeneID | 3965 |
Spec:NCBI Gene Aliases | HUAT; LGALS9A |
Spec:SwissProtID | Q3B8N1 |
NCBI Reference | O00182 |
Aliases /Synonyms | LGALS9、Medium, Gal-9delta5、D5,Gal-9、Ecalectin、Tumor antigen HOM-HD-21 |
Reference | PX-P4585 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.