Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Growth/differentiation factor 9(GDF9) |
---|---|
Uniprot ID | O60383 |
Uniprot link | https://www.uniprot.org/uniprot/O60383 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVG HRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR |
Molecular weight | 15.49 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5, 0.02% SKL |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Applications | ELISA,WB |
Fragment Type | Gly320-Arg454 |
Protein Accession | O60383 |
Spec:Entrez GeneID | 2661 |
Spec:NCBI Gene Aliases | POF14 |
Spec:SwissProtID | Q4VAW5 |
NCBI Reference | O60383 |
Aliases /Synonyms | GDF-9 |
Reference | PX-P4783 |
Note | For research use only |
Reviews
Il n’y a pas encore d’avis.