Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human Beta-nerve Growth Factor proteins recombinant protein |
---|---|
Uniprot ID | P01138 |
Uniprot link | http://www.uniprot.org/uniprot/P01138 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRASRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
Molecular weight | 53.31kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 70% |
Buffer | 0.1M Tris-HCl, 0.1M Glycine, pH=7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Full-length |
Aliases /Synonyms | NGF, NGFB, Beta-NGF, HSAN5, NGF-B, Beta-Nerve Growth Factor proteins |
Reference | PX-P4027 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.