Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human CD126, IL6R, Interleukin-6 receptor subunit alpha recombinant protein |
---|---|
Uniprot ID | P08887 |
Uniprot link | http://www.uniprot.org/uniprot/P08887 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPGSHHHHHH |
Molecular weight | 41.12kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 80% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
Aliases /Synonyms | CD126, gp80, IL6R, IL-6R-1, IL-6R-Alpha, IL6RA, IL-6 receptor subunit alpha, Membrane glycoprotein 80 |
Reference | PX-P4046 |
Note | For research use only |
A portion of the interleukin 6 receptor, which binds to IL6 with low affinity, but does not transmit signals (PubMed: 28265003). Signal activation must be related to IL6ST. Activation leads to immune response, acute phase response, and regulation of hematopoietic function (possibly). The interaction of membrane-bound IL6R and IL6ST stimulates “classical signaling” and the limited expression of IL6R limits classical IL6 signaling to only a few tissues, such as the liver and some cells of the immune system. In the process of binding of IL6R and soluble IL6R to IL6ST, “anti-signal transmission” is stimulated. Furthermore, when the membrane-bound IL6: IL6R complex on the transmitting cell activates the IL6ST receptor on the adjacent receptor, the “raster signal” will (possibly) occur
Related products
Reviews
Il n’y a pas encore d’avis.