Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human CD58: LFA3 recombinant protein |
---|---|
Uniprot ID | P19256 |
Uniprot link | http://www.uniprot.org/uniprot/P19256 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRGSHHHHHH |
Molecular weight | 25.19kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | 50 mM Tris-HCl pH 7.5, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
Aliases /Synonyms | CD58, Ag3, Surface glycoprotein LFA-3, LFA3, Lymphocyte Function Associated Antigen 3 |
Reference | PX-P4023 |
Note | For research use only |
Related products
Reviews
Il n’y a pas encore d’avis.