Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | |
Product type | |
Host Species | |
Applications |
Product name | Human CD80, B7-1 recombinant protein |
---|---|
Uniprot ID | P33681 |
Uniprot link | http://www.uniprot.org/uniprot/P33681 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNGSHHHHHH |
Molecular weight | 28.52kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 90% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
Aliases /Synonyms | CD80, CD28LG, CD28LG1, BB1, B7-1 Antigen, T-lymphocyte activation antigen CD80, CTLA-4 counter-receptor B7.1 |
Reference | PX-P4040 |
Note | For research use only |
Cluster of Differentiation 80 (CD80/B7-1), recombinant human protein is supplied as a lyophilized powder. It is suitable for analysis of protein structure, investigation of protein-protein interactions, and specific biological research applications. It can also be used as an immunogen or protein standard.
Related products
Reviews
Il n’y a pas encore d’avis.